|
Tbg.972.2.1440 | Tbg.972.2.1440:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2439 | Tbg.972.2.1440 | chaperone protein ClpB1, putative | chaperone protein ClpB1, putative | | | 2 | Tbg972_02:282,361..284,799(+) | Tbg972_02:282361..284799(+) | Tbg972_02 | Trypanosoma brucei gambiense DAL972 | 141 | OG6_100223 | 1 | 812 | 2439 | 90664 | 7.53 | 0 | | | | | GO:0005524 | ATP binding | | | GO:0005737;GO:0009841;GO:0005739;GO:0005654;GO:0005886 | cytoplasm;mitochondrial endopeptidase Clp complex;mitochondrion;nucleoplasm;plasma membrane | GO:0003754;GO:0004252 | obsolete chaperone activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg.972.2.1440ORchaperone protein ClpB1, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg.972.2.1440 OR chaperone protein ClpB1, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg.972.2.1890 | Tbg.972.2.1890:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 822 | Tbg.972.2.1890 | cysteine peptidase, Clan CA, family C51, putative | cysteine peptidase, Clan CA, family C51, putative | | | 2 | Tbg972_02:367,320..368,141(-) | Tbg972_02:367320..368141(-) | Tbg972_02 | Trypanosoma brucei gambiense DAL972 | 102 | OG6_115782 | 1 | 273 | 822 | 29985 | 8.70 | 1 | | | | | | | | | | | GO:0003674 | molecular_function | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg.972.2.1890ORcysteine peptidase, Clan CA, family C51, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg.972.2.1890 OR cysteine peptidase, Clan CA, family C51, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg.972.2.1900 | Tbg.972.2.1900:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 843 | Tbg.972.2.1900 | cysteine peptidase, Clan CA, family C51, putative | cysteine peptidase, Clan CA, family C51, putative | | | 2 | Tbg972_02:369,311..370,153(-) | Tbg972_02:369311..370153(-) | Tbg972_02 | Trypanosoma brucei gambiense DAL972 | 102 | OG6_115782 | 1 | 280 | 843 | 30982 | 8.63 | 1 | | | | | | | | | | | GO:0003674 | molecular_function | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg.972.2.1900ORcysteine peptidase, Clan CA, family C51, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg.972.2.1900 OR cysteine peptidase, Clan CA, family C51, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg.972.2.2270 | Tbg.972.2.2270:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1410 | Tbg.972.2.2270 | Mitochondrial-processing peptidase subunit alpha | Mitochondrial-processing peptidase subunit alpha | | | 2 | Tbg972_02:455,764..457,173(-) | Tbg972_02:455764..457173(-) | Tbg972_02 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_102381 | 0 | 469 | 1410 | 52050 | 7.11 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005737;GO:0017087 | cytoplasm;mitochondrial processing peptidase complex | GO:0004222 | metalloendopeptidase activity | GO:0030150 | protein import into mitochondrial matrix | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg.972.2.2270ORMitochondrial-processing peptidase subunit alphaANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg.972.2.2270 OR Mitochondrial-processing peptidase subunit alpha AND Trypanosoma brucei gambiense DAL972 |
|
Tbg.972.2.2440 | Tbg.972.2.2440:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1884 | Tbg.972.2.2440 | trypanothione synthetase | trypanothione synthetase | | | 2 | Tbg972_02:500,094..501,977(-) | Tbg972_02:500094..501977(-) | Tbg972_02 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_111169 | 0 | 627 | 1884 | 71642 | 6.06 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | 3.5.1.78 (Glutathionylspermidine amidase);6.3.1.9 (Trypanothione synthase) | 3.5.1.78 (Glutathionylspermidine amidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg.972.2.2440ORtrypanothione synthetaseANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg.972.2.2440 OR trypanothione synthetase AND Trypanosoma brucei gambiense DAL972 |
|
Tbg.972.2.4100 | Tbg.972.2.4100:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 924 | Tbg.972.2.4100 | hypothetical protein, conserved | hypothetical protein, conserved | | | 2 | Tbg972_02:798,821..799,744(+) | Tbg972_02:798821..799744(+) | Tbg972_02 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_137919 | 0 | 307 | 924 | 32907 | 8.29 | 0 | NN: MTTASVSQSCFPIMSFLHVPGKMSQPLWLMMGTAFLVNVSRRTGAA, HMM: MTTASVSQSCFPIMSFLHVPGKMSQPLWLMMGTAFLVNVSRRTGAA | NN Sum: 2, NN D: .24, HMM Prob: .53 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg.972.2.4100ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg.972.2.4100 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |
|
Tbg.972.2.4200 | Tbg.972.2.4200:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2613 | Tbg.972.2.4200 | chaperone protein ClpB1, putative | chaperone protein ClpB1, putative | | | 2 | Tbg972_02:827,173..829,785(+) | Tbg972_02:827173..829785(+) | Tbg972_02 | Trypanosoma brucei gambiense DAL972 | 141 | OG6_100223 | 1 | 870 | 2613 | 97037 | 6.28 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0005737;GO:0005739;GO:0005654;GO:0005886 | cytoplasm;mitochondrion;nucleoplasm;plasma membrane | GO:0016887 | ATPase activity | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg.972.2.4200ORchaperone protein ClpB1, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg.972.2.4200 OR chaperone protein ClpB1, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.1.1230 | Tbg972.1.1230:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3237 | Tbg972.1.1230 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 1 | Tbg972_01:309,807..313,043(+) | Tbg972_01:309807..313043(+) | Tbg972_01 | Trypanosoma brucei gambiense DAL972 | 137 | OG6_127587 | 1 | 1078 | 3237 | 119092 | 4.51 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0003674 | molecular_function | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.1.1230ORcysteine peptidase, Clan CA, family C2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.1.1230 OR cysteine peptidase, Clan CA, family C2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.1.1240 | Tbg972.1.1240:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2049 | Tbg972.1.1240 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 1 | Tbg972_01:314,295..316,343(+) | Tbg972_01:314295..316343(+) | Tbg972_01 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_155901 | 0 | 682 | 2049 | 75509 | 4.92 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930;GO:0005737 | axoneme;cytoplasm | GO:0003674 | molecular_function | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.1.1240ORcysteine peptidase, Clan CA, family C2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.1.1240 OR cysteine peptidase, Clan CA, family C2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.1.1280 | Tbg972.1.1280:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 5244 | Tbg972.1.1280 | Raptor N-terminal CASPase like domain containing protein, putative | Raptor N-terminal CASPase like domain containing protein, putative | | | 1 | Tbg972_01:330,197..335,440(+) | Tbg972_01:330197..335440(+) | Tbg972_01 | Trypanosoma brucei gambiense DAL972 | 55 | OG6_147359 | 0 | 1747 | 5244 | 188263 | 6.78 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.1.1280ORRaptor N-terminal CASPase like domain containing protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.1.1280 OR Raptor N-terminal CASPase like domain containing protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.1.1810 | Tbg972.1.1810:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1209 | Tbg972.1.1810 | amidohydrolase, putative | amidohydrolase, putative | | | 1 | Tbg972_01:438,405..439,613(+) | Tbg972_01:438405..439613(+) | Tbg972_01 | Trypanosoma brucei gambiense DAL972 | 185 | OG6_101553 | 0 | 402 | 1209 | 42867 | 6.27 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | GO:0016787 | hydrolase activity | GO:0006508 | proteolysis | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.1.1810ORamidohydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.1.1810 OR amidohydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.1.3290 | Tbg972.1.3290:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2244 | Tbg972.1.3290 | Alpha/beta hydrolase domain-containing protein | Alpha/beta hydrolase domain-containing protein | | | 1 | Tbg972_01:728,099..730,342(+) | Tbg972_01:728099..730342(+) | Tbg972_01 | Trypanosoma brucei gambiense DAL972 | 87 | OG6_100915 | 0 | 747 | 2244 | 83108 | 6.62 | 2 | NN: MFYDHVVSVLVIQFLSFSSLFLS, HMM: MFYDHVVSVLVIQFLSFSSLFLS | NN Sum: 2, NN D: .55, HMM Prob: .26 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.1.3290ORAlpha/beta hydrolase domain-containing proteinANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.1.3290 OR Alpha/beta hydrolase domain-containing protein AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.10680 | Tbg972.10.10680:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 798 | Tbg972.10.10680 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | | 10 | Tbg972_10:2,092,094..2,092,891(+) | Tbg972_10:2092094..2092891(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_102949 | 0 | 265 | 798 | 29422 | 6.93 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.10680OROTU-like cysteine protease, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.10680 OR OTU-like cysteine protease, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.11910 | Tbg972.10.11910:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1227 | Tbg972.10.11910 | Regulatory particle triple-A ATPase subunit 6 | Regulatory particle triple-A ATPase subunit 6 | | | 10 | Tbg972_10:2,324,914..2,326,140(+) | Tbg972_10:2324914..2326140(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_101513 | 0 | 408 | 1227 | 45729 | 8.76 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654;GO:0005838 | cytoplasm;nucleoplasm;proteasome regulatory particle | GO:0016887 | ATPase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.11910ORRegulatory particle triple-A ATPase subunit 6ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.11910 OR Regulatory particle triple-A ATPase subunit 6 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.11990 | Tbg972.10.11990:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2028 | Tbg972.10.11990 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | | | 10 | Tbg972_10:2,346,951..2,348,978(+) | Tbg972_10:2346951..2348978(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_102110 | 0 | 675 | 2028 | 76716 | 6.44 | 0 | NN: MLRRVTPFTLCASGFTACRWAG, HMM: MLRRVTPFTLCASGFTACRWAG | NN Sum: 1, NN D: .35, HMM Prob: .92 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.11990ORmitochondrial intermediate peptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.11990 OR mitochondrial intermediate peptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.13020 | Tbg972.10.13020:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 4713 | Tbg972.10.13020 | metallo-peptidase, Clan MC, Family M14, putative | metallo-peptidase, Clan MC, Family M14, putative | | | 10 | Tbg972_10:2,522,483..2,527,195(-) | Tbg972_10:2522483..2527195(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_101273 | 0 | 1570 | 4713 | 172103 | 6.93 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0004182 | obsolete carboxypeptidase A activity | GO:0006508 | proteolysis | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.13020ORmetallo-peptidase, Clan MC, Family M14, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.13020 OR metallo-peptidase, Clan MC, Family M14, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.1360 | Tbg972.10.1360:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1401 | Tbg972.10.1360 | serine peptidase, Clan SC, Family S10 | serine peptidase, Clan SC, Family S10 | | | 10 | Tbg972_10:273,001..274,401(+) | Tbg972_10:273001..274401(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 155 | OG6_100109 | 3 | 466 | 1401 | 51845 | 4.76 | 1 | NN: MRLISYPVMLSLLAACILVVVLAN, HMM: MRLISYPVMLSLLAACILVVVLAN | NN Sum: 4, NN D: .8, HMM Prob: .96 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | 3.4.16.5 (Carboxypeptidase C) | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.1360ORserine peptidase, Clan SC, Family S10ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.1360 OR serine peptidase, Clan SC, Family S10 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.1380 | Tbg972.10.1380:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1392 | Tbg972.10.1380 | serine carboxypeptidase III precursor, putative | serine carboxypeptidase III precursor, putative | | | 10 | Tbg972_10:275,019..276,410(+) | Tbg972_10:275019..276410(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 155 | OG6_100109 | 3 | 463 | 1392 | 51379 | 4.15 | 0 | HMM: MLCHTSLFLISLLLLLQSASAL, NN: MLCHTSLFLISLLLLLQSASAL | NN Sum: 4, NN D: .91, HMM Prob: 1 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.16.5 (Carboxypeptidase C) | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.1380ORserine carboxypeptidase III precursor, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.1380 OR serine carboxypeptidase III precursor, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.140 | Tbg972.10.140:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 741 | Tbg972.10.140 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | | | 10 | Tbg972_10:19,269..20,009(+) | Tbg972_10:19269..20009(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_101621 | 0 | 246 | 741 | 27204 | 4.64 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005829;GO:0005634;GO:0005839 | cytosol;nucleus;proteasome core complex | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.140ORproteasome subunit alpha type-5, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.140 OR proteasome subunit alpha type-5, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.1400 | Tbg972.10.1400:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1392 | Tbg972.10.1400 | serine carboxypeptidase III precursor, putative | serine carboxypeptidase III precursor, putative | | | 10 | Tbg972_10:277,028..278,419(+) | Tbg972_10:277028..278419(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 155 | OG6_100109 | 3 | 463 | 1392 | 51379 | 4.15 | 0 | NN: MLCHTSLFLISLLLLLQSASAL, HMM: MLCHTSLFLISLLLLLQSASAL | NN Sum: 4, NN D: .91, HMM Prob: 1 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.16.5 (Carboxypeptidase C) | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.1400ORserine carboxypeptidase III precursor, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.1400 OR serine carboxypeptidase III precursor, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.1410 | Tbg972.10.1410:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1392 | Tbg972.10.1410 | serine carboxypeptidase III precursor, putative | serine carboxypeptidase III precursor, putative | | | 10 | Tbg972_10:278,744..280,135(+) | Tbg972_10:278744..280135(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 155 | OG6_100109 | 3 | 463 | 1392 | 51101 | 4.36 | 0 | NN: MLCHTSLFLISLLLLLQSASAL, HMM: MLCHTSLFLISLLLLLQSASAL | NN Sum: 4, NN D: .91, HMM Prob: 1 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.1410ORserine carboxypeptidase III precursor, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.1410 OR serine carboxypeptidase III precursor, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.14780 | Tbg972.10.14780:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1428 | Tbg972.10.14780 | cytosolic nonspecific dipeptidase, putative | cytosolic nonspecific dipeptidase, putative | | | 10 | Tbg972_10:2,867,474..2,868,901(+) | Tbg972_10:2867474..2868901(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 94 | OG6_100503 | 1 | 475 | 1428 | 51517 | 6.29 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0005737 | cytoplasm | GO:0008237 | metallopeptidase activity | GO:0006508 | proteolysis | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.14780ORcytosolic nonspecific dipeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.14780 OR cytosolic nonspecific dipeptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.15460 | Tbg972.10.15460:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3042 | Tbg972.10.15460 | hypothetical protein, conserved | hypothetical protein, conserved | | | 10 | Tbg972_10:2,996,512..2,999,553(-) | Tbg972_10:2996512..2999553(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_156926 | 0 | 1013 | 3042 | 110243 | 6.86 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.15460ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.15460 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.15720 | Tbg972.10.15720:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2241 | Tbg972.10.15720 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 10 | Tbg972_10:3,047,663..3,049,903(-) | Tbg972_10:3047663..3049903(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 39 | OG6_158065 | 0 | 746 | 2241 | 83573 | 6.05 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.15720ORcysteine peptidase, Clan CA, family C2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.15720 OR cysteine peptidase, Clan CA, family C2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.1620 | Tbg972.10.1620:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1392 | Tbg972.10.1620 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | | 10 | Tbg972_10:322,617..324,008(-) | Tbg972_10:322617..324008(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_100815 | 0 | 463 | 1392 | 51425 | 6.51 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0008237 | metallopeptidase activity | GO:0006508 | proteolysis | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.1620ORmetallo-peptidase, Clan MG, Family M24ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.1620 OR metallo-peptidase, Clan MG, Family M24 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.16310 | Tbg972.10.16310:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1710 | Tbg972.10.16310 | zinc metallopeptidase, putative | zinc metallopeptidase, putative | | | 10 | Tbg972_10:3,179,450..3,181,159(-) | Tbg972_10:3179450..3181159(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_139899 | 0 | 569 | 1710 | 62807 | 6.11 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.16310ORzinc metallopeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.16310 OR zinc metallopeptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.17040 | Tbg972.10.17040:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 960 | Tbg972.10.17040 | cysteine peptidase, Clan CD, family C13, putative | cysteine peptidase, Clan CD, family C13, putative | | | 10 | Tbg972_10:3,304,105..3,305,064(-) | Tbg972_10:3304105..3305064(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_101767 | 0 | 319 | 960 | 36812 | 5.80 | 0 | HMM: MLPMLLWLVANLFLAPAAEGF, NN: MLPMLLWLVANLFLAPAAEGF | NN Sum: 4, NN D: .86, HMM Prob: 1 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | GO:0005783;GO:0005635 | endoplasmic reticulum;nuclear envelope | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.17040ORcysteine peptidase, Clan CD, family C13, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.17040 OR cysteine peptidase, Clan CD, family C13, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.17670 | Tbg972.10.17670:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1146 | Tbg972.10.17670 | 19S proteasome non-atpase subunit 8 | 19S proteasome non-atpase subunit 8 | | | 10 | Tbg972_10:3,437,648..3,438,793(-) | Tbg972_10:3437648..3438793(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_102054 | 0 | 381 | 1146 | 42282 | 5.58 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005838 | proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.17670OR19S proteasome non-atpase subunit 8ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.17670 OR 19S proteasome non-atpase subunit 8 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.17950 | Tbg972.10.17950:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1149 | Tbg972.10.17950 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | | 10 | Tbg972_10:3,486,287..3,487,435(-) | Tbg972_10:3486287..3487435(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_101895 | 0 | 382 | 1149 | 42675 | 6.20 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.17950ORmetallo-peptidase, Clan MG, Family M24ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.17950 OR metallo-peptidase, Clan MG, Family M24 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.18570 | Tbg972.10.18570:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1188 | Tbg972.10.18570 | metallo- peptidase, Clan MG, Family M24 | metallo- peptidase, Clan MG, Family M24 | | | 10 | Tbg972_10:3,602,486..3,603,673(+) | Tbg972_10:3602486..3603673(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 55 | OG6_100342 | 0 | 395 | 1188 | 43895 | 6.73 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.18570ORmetallo- peptidase, Clan MG, Family M24ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.18570 OR metallo- peptidase, Clan MG, Family M24 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.19790 | Tbg972.10.19790:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1734 | Tbg972.10.19790 | metallo-peptidase, Clan MA(E) Family M41 | metallo-peptidase, Clan MA(E) Family M41 | | | 10 | Tbg972_10:3,868,257..3,869,990(+) | Tbg972_10:3868257..3869990(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 67 | OG6_139691 | 0 | 577 | 1734 | 62720 | 7.97 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | GO:0016887 | ATPase activity | GO:0006508 | proteolysis | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.19790ORmetallo-peptidase, Clan MA(E) Family M41ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.19790 OR metallo-peptidase, Clan MA(E) Family M41 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.200 | Tbg972.10.200:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 798 | Tbg972.10.200 | proteasome alpha 2 subunit, putative | proteasome alpha 2 subunit, putative | | | 10 | Tbg972_10:26,402..27,199(+) | Tbg972_10:26402..27199(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_101969 | 0 | 265 | 798 | 29379 | 6.66 | 0 | HMM: MLFPLILPPIPFMKEESFIFFCLLVLCNTRLCR, NN: MLFPLILPPIPFMKEESFIFFCLLVLCNTRLCRPM | NN Sum: 2, NN D: .43, HMM Prob: .94 | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005839 | cytoplasm;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.200ORproteasome alpha 2 subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.200 OR proteasome alpha 2 subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.2280 | Tbg972.10.2280:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4785 | Tbg972.10.2280 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 10 | Tbg972_10:438,685..443,469(+) | Tbg972_10:438685..443469(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 54 | OG6_148289 | 0 | 1594 | 4785 | 178016 | 5.52 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930 | axoneme | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.2280ORcysteine peptidase, Clan CA, family C2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.2280 OR cysteine peptidase, Clan CA, family C2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.2590 | Tbg972.10.2590:pseudogenic_transcript | 1 | 1 | 1 | | | forward | protein coding | Yes | 1197 | Tbg972.10.2590 | mitochondrial processing peptidase alpha subunit (pseudogene), putative | mitochondrial processing peptidase alpha subunit (pseudogene), putative | | | 10 | Tbg972_10:503,800..504,996(+) | Tbg972_10:503800..504996(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 0 | N/A (orthology not determined because poor protein quality) | 0 | 398 | 1197 | 44237 | 6.92 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.2590ORmitochondrial processing peptidase alpha subunit (pseudogene), putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.2590 OR mitochondrial processing peptidase alpha subunit (pseudogene), putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.2680 | Tbg972.10.2680:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1989 | Tbg972.10.2680 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | | | 10 | Tbg972_10:516,127..518,115(+) | Tbg972_10:516127..518115(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 21 | OG6_166456 | 0 | 662 | 1989 | 73334 | 8.23 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | GO:0004197;GO:0004221 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.2680ORPeptidase C19, ubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.2680 OR Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.3730 | Tbg972.10.3730:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 918 | Tbg972.10.3730 | proteasome regulatory non-ATPase subunit 11, putative | proteasome regulatory non-ATPase subunit 11, putative | | | 10 | Tbg972_10:729,081..729,998(+) | Tbg972_10:729081..729998(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 57 | OG6_101835 | 1 | 305 | 918 | 33847 | 6.52 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737;GO:0005838 | cytoplasm;proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.3730ORproteasome regulatory non-ATPase subunit 11, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.3730 OR proteasome regulatory non-ATPase subunit 11, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.3790 | Tbg972.10.3790:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 918 | Tbg972.10.3790 | proteasome regulatory non-ATPase subunit 11, putative | proteasome regulatory non-ATPase subunit 11, putative | | | 10 | Tbg972_10:745,323..746,240(+) | Tbg972_10:745323..746240(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 57 | OG6_101835 | 1 | 305 | 918 | 33847 | 6.52 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737;GO:0005838 | cytoplasm;proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.3790ORproteasome regulatory non-ATPase subunit 11, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.3790 OR proteasome regulatory non-ATPase subunit 11, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.4380 | Tbg972.10.4380:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1200 | Tbg972.10.4380 | Tbgamb.27571 protease regulatory ATPase subunit, putative | Tbgamb.27571 protease regulatory ATPase subunit, putative | | | 10 | Tbg972_10:861,041..862,240(+) | Tbg972_10:861041..862240(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_101751 | 0 | 399 | 1200 | 44883 | 7.70 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005838 | proteasome regulatory particle | | | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.4380ORTbgamb.27571 protease regulatory ATPase subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.4380 OR Tbgamb.27571 protease regulatory ATPase subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.5610 | Tbg972.10.5610:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 624 | Tbg972.10.5610 | serine peptidase clan SF, family S26B, putative | serine peptidase clan SF, family S26B, putative | | | 10 | Tbg972_10:1,119,515..1,120,138(-) | Tbg972_10:1119515..1120138(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 47 | OG6_132331 | 0 | 207 | 624 | 22925 | 6.35 | 0 | | | | | | | | | GO:0020023;GO:0005739 | kinetoplast;mitochondrion | GO:0008236 | serine-type peptidase activity | GO:0006508;GO:0006465 | proteolysis;signal peptide processing | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.5610ORserine peptidase clan SF, family S26B, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.5610 OR serine peptidase clan SF, family S26B, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.5730 | Tbg972.10.5730:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 621 | Tbg972.10.5730 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | | | 10 | Tbg972_10:1,135,738..1,136,358(-) | Tbg972_10:1135738..1136358(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_102061 | 0 | 206 | 621 | 22776 | 6.76 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0019774 | cytoplasm;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.5730ORproteasome subunit beta type-2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.5730 OR proteasome subunit beta type-2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.7030 | Tbg972.10.7030:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1611 | Tbg972.10.7030 | hypothetical protein, conserved | hypothetical protein, conserved | | | 10 | Tbg972_10:1,384,935..1,386,545(-) | Tbg972_10:1384935..1386545(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_146679 | 0 | 536 | 1611 | 59193 | 7.38 | 0 | | | | | GO:0005488;GO:0005515 | binding;protein binding | | | GO:0005739 | mitochondrion | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.7030ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.7030 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.7380 | Tbg972.10.7380:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 801 | Tbg972.10.7380 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | | | 10 | Tbg972_10:1,465,707..1,466,507(-) | Tbg972_10:1465707..1466507(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_102143 | 0 | 266 | 801 | 29334 | 5.19 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654;GO:0005839 | cytoplasm;nucleoplasm;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.7380ORproteasome subunit alpha type-1, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.7380 OR proteasome subunit alpha type-1, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.7450 | Tbg972.10.7450:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 933 | Tbg972.10.7450 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | | | 10 | Tbg972_10:1,481,389..1,482,321(-) | Tbg972_10:1481389..1482321(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_100897 | 0 | 310 | 933 | 34415 | 6.62 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0019774 | proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.7450ORproteasome subunit beta type-5, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.7450 OR proteasome subunit beta type-5, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.7490 | Tbg972.10.7490:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 741 | Tbg972.10.7490 | Peptidase M76 family, putative | Peptidase M76 family, putative | | | 10 | Tbg972_10:1,490,071..1,490,811(-) | Tbg972_10:1490071..1490811(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_102968 | 0 | 246 | 741 | 27225 | 5.44 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | GO:0005737 | cytoplasm | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.7490ORPeptidase M76 family, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.7490 OR Peptidase M76 family, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.7780 | Tbg972.10.7780:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 660 | Tbg972.10.7780 | hypothetical protein, conserved | hypothetical protein, conserved | | | 10 | Tbg972_10:1,561,551..1,562,210(-) | Tbg972_10:1561551..1562210(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 8 | OG6_102074 | 0 | 219 | 660 | 23984 | 8.29 | 0 | | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.7780ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.7780 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.8500 | Tbg972.10.8500:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2553 | Tbg972.10.8500 | serine peptidase, Clan SC, Family S9B | serine peptidase, Clan SC, Family S9B | | | 10 | Tbg972_10:1,691,550..1,694,102(+) | Tbg972_10:1691550..1694102(+) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 57 | OG6_102236 | 0 | 850 | 2553 | 93826 | 6.45 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.8500ORserine peptidase, Clan SC, Family S9BANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.8500 OR serine peptidase, Clan SC, Family S9B AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.8940 | Tbg972.10.8940:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3468 | Tbg972.10.8940 | Flagellar Member 2 | Flagellar Member 2 | | | 10 | Tbg972_10:1,775,085..1,778,552(-) | Tbg972_10:1775085..1778552(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_146571 | 0 | 1155 | 3468 | 129960 | 6.51 | 0 | | | | | | | | | GO:0005930;GO:0031514 | axoneme;motile cilium | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.8940ORFlagellar Member 2ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.8940 OR Flagellar Member 2 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.9320 | Tbg972.10.9320:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1974 | Tbg972.10.9320 | mitochondrial ATP-dependent zinc metallopeptidase, putative | mitochondrial ATP-dependent zinc metallopeptidase, putative | | | 10 | Tbg972_10:1,855,720..1,857,693(-) | Tbg972_10:1855720..1857693(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_101196 | 0 | 657 | 1974 | 71130 | 8.04 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005739 | cytoplasm;mitochondrion | GO:0016887;GO:0004222;GO:0051082 | ATPase activity;metalloendopeptidase activity;unfolded protein binding | GO:0007049;GO:0006508 | cell cycle;proteolysis | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.9320ORmitochondrial ATP-dependent zinc metallopeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.9320 OR mitochondrial ATP-dependent zinc metallopeptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.10.9810 | Tbg972.10.9810:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2097 | Tbg972.10.9810 | prolyl endopeptidase | prolyl endopeptidase | | | 10 | Tbg972_10:1,935,610..1,937,706(-) | Tbg972_10:1935610..1937706(-) | Tbg972_10 | Trypanosoma brucei gambiense DAL972 | 64 | OG6_101804 | 0 | 698 | 2097 | 77596 | 6.16 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0070012 | oligopeptidase activity | | | 3.4.21.26 (Prolyl oligopeptidase) | 3.4.21.26 (Prolyl oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.10.9810ORprolyl endopeptidaseANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.10.9810 OR prolyl endopeptidase AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.11500 | Tbg972.11.11500:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 630 | Tbg972.11.11500 | ATP-dependent protease subunit HslV, putative | ATP-dependent protease subunit HslV, putative | | | 11 | Tbg972_11:2,715,837..2,716,466(+) | Tbg972_11:2715837..2716466(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_107204 | 0 | 209 | 630 | 22683 | 6.54 | 0 | | | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | GO:0009376;GO:0097014;GO:0005737;GO:0042645;GO:0005739;GO:0031981 | HslUV protease complex;ciliary plasm;cytoplasm;mitochondrial nucleoid;mitochondrion;nuclear lumen | GO:0004176 | ATP-dependent peptidase activity | GO:0033955;GO:0006264;GO:0070581 | mitochondrial DNA inheritance;mitochondrial DNA replication;rolling circle DNA replication | 3.4.25.2 (HslU--HslV peptidase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.11500ORATP-dependent protease subunit HslV, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.11500 OR ATP-dependent protease subunit HslV, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.11550 | Tbg972.11.11550:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3579 | Tbg972.11.11550 | metallo-peptidase, Clan MC, Family M14, putative | metallo-peptidase, Clan MC, Family M14, putative | | | 11 | Tbg972_11:2,723,620..2,727,198(+) | Tbg972_11:2723620..2727198(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_142418 | 0 | 1192 | 3579 | 131208 | 8.69 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0004182 | obsolete carboxypeptidase A activity | GO:0006508 | proteolysis | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.11550ORmetallo-peptidase, Clan MC, Family M14, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.11550 OR metallo-peptidase, Clan MC, Family M14, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.1170 | Tbg972.11.1170:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 5610 | Tbg972.11.1170 | calpain-like protein, putative, (fragment) | calpain-like protein, putative, (fragment) | | | 11 | Tbg972_11:250,469..256,078(+) | Tbg972_11:250469..256078(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 314 | OG6_115879 | 3 | 1870 | 5610 | 212944 | 4.87 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.1170ORcalpain-like protein, putative, (fragment)ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.1170 OR calpain-like protein, putative, (fragment) AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.1180 | Tbg972.11.1180:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3696 | Tbg972.11.1180 | calpain-like protein, putative | calpain-like protein, putative | | | 11 | Tbg972_11:256,403..260,098(+) | Tbg972_11:256403..260098(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 314 | OG6_115879 | 3 | 1231 | 3696 | 138979 | 5.77 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.1180ORcalpain-like protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.1180 OR calpain-like protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.1190 | Tbg972.11.1190:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 18396 | Tbg972.11.1190 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 11 | Tbg972_11:262,652..281,047(+) | Tbg972_11:262652..281047(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 314 | OG6_115879 | 3 | 6131 | 18396 | 697060 | 4.98 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.1190ORcysteine peptidase, Clan CA, family C2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.1190 OR cysteine peptidase, Clan CA, family C2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.120 | Tbg972.11.120:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 711 | Tbg972.11.120 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 11 | Tbg972_11:27,605..28,315(-) | Tbg972_11:27605..28315(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_101218 | 0 | 236 | 711 | 25925 | 4.42 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.120ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.120 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.1200 | Tbg972.11.1200:mRNA | 2 | 1 | 1 | | | forward | protein coding | Yes | 26682 | Tbg972.11.1200 | calpain-like protein, putative (pseudogene) | calpain-like protein, putative (pseudogene) | | | 11 | Tbg972_11:281,984..308,666(+) | Tbg972_11:281984..308666(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 0 | N/A (orthology not determined because poor protein quality) | 0 | 8894 | 26682 | 1006532 | 4.48 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.1200ORcalpain-like protein, putative (pseudogene)ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.1200 OR calpain-like protein, putative (pseudogene) AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.1210 | Tbg972.11.1210:mRNA | 1 | 1 | 1 | 2 | | forward | protein coding | No | 4586 | Tbg972.11.1210 | T. brucei spp.-specific protein, (fragment) | T. brucei spp.-specific protein, (fragment) | | | 11 | Tbg972_11:308,769..313,354(+) | Tbg972_11:308769..313352(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 314 | OG6_115879 | 3 | 1528 | 4584 | 175188 | 5.49 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.1210ORT. brucei spp.-specific protein, (fragment)ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.1210 OR T. brucei spp.-specific protein, (fragment) AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.12640 | Tbg972.11.12640:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1497 | Tbg972.11.12640 | hypothetical protein, conserved | hypothetical protein, conserved | | | 11 | Tbg972_11:2,998,762..3,000,258(+) | Tbg972_11:2998762..3000258(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_147553 | 0 | 498 | 1497 | 55600 | 8.26 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.12640ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.12640 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.13680 | Tbg972.11.13680:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2373 | Tbg972.11.13680 | cysteine peptidase, Clan CA, family C19, putative | cysteine peptidase, Clan CA, family C19, putative | | | 11 | Tbg972_11:3,241,607..3,243,979(+) | Tbg972_11:3241607..3243979(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_103732 | 0 | 790 | 2373 | 89184 | 6.30 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0005741 | cytoplasm;mitochondrial outer membrane | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.13680ORcysteine peptidase, Clan CA, family C19, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.13680 OR cysteine peptidase, Clan CA, family C19, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.14050 | Tbg972.11.14050:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 762 | Tbg972.11.14050 | Der1-like family, putative | Der1-like family, putative | | | 11 | Tbg972_11:3,336,271..3,337,032(+) | Tbg972_11:3336271..3337032(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 96 | OG6_101672 | 0 | 253 | 762 | 27966 | 9.37 | 3 | | | | | | | | | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.14050ORDer1-like family, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.14050 OR Der1-like family, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.14070 | Tbg972.11.14070:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1005 | Tbg972.11.14070 | cyclin 1 | cyclin 1 | | | 11 | Tbg972_11:3,340,779..3,341,783(+) | Tbg972_11:3340779..3341783(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_127800 | 0 | 334 | 1005 | 36294 | 5.66 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.14070ORcyclin 1ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.14070 OR cyclin 1 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.14320 | Tbg972.11.14320:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2148 | Tbg972.11.14320 | oligopeptidase b | oligopeptidase b | | | 11 | Tbg972_11:3,407,149..3,409,296(-) | Tbg972_11:3407149..3409296(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 107 | OG6_102873 | 1 | 715 | 2148 | 80680 | 6.29 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.21.83 (Oligopeptidase B) | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.14320ORoligopeptidase bANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.14320 OR oligopeptidase b AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.15030 | Tbg972.11.15030:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 711 | Tbg972.11.15030 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | | 11 | Tbg972_11:3,563,915..3,564,625(-) | Tbg972_11:3563915..3564625(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 123 | OG6_101256 | 2 | 236 | 711 | 26244 | 6.37 | 0 | HMM: MEQGQPATPFAGLASGVAAT, NN: MEQGQPATPFAGLASGVAAT | NN Sum: 1, NN D: .31, HMM Prob: .59 | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.15030ORPPPDE putative peptidase domain containing protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.15030 OR PPPDE putative peptidase domain containing protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.15880 | Tbg972.11.15880:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4515 | Tbg972.11.15880 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 11 | Tbg972_11:3,724,293..3,728,807(+) | Tbg972_11:3724293..3728807(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_147050 | 0 | 1504 | 4515 | 165416 | 6.91 | 0 | NN: MLTIPLPLSLVYFRTVPLITAF, HMM: MLTIPLPLSLVYFRTVPLITAF | NN Sum: 4, NN D: .67, HMM Prob: .91 | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.15880ORcysteine peptidase, Clan CA, family C2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.15880 OR cysteine peptidase, Clan CA, family C2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.16220 | Tbg972.11.16220:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1329 | Tbg972.11.16220 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 11 | Tbg972_11:3,806,073..3,807,401(+) | Tbg972_11:3806073..3807401(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 47 | OG6_103260 | 0 | 442 | 1329 | 48885 | 8.71 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737 | cytoplasm | GO:0004197;GO:0004221;GO:0004843 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.16220ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.16220 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.16260 | Tbg972.11.16260:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1671 | Tbg972.11.16260 | WLM domain containing protein, putative | WLM domain containing protein, putative | | | 11 | Tbg972_11:3,813,904..3,815,574(+) | Tbg972_11:3813904..3815574(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 24 | OG6_108834 | 0 | 556 | 1671 | 62207 | 6.66 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.16260ORWLM domain containing protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.16260 OR WLM domain containing protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.16280 | Tbg972.11.16280:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1791 | Tbg972.11.16280 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | | 11 | Tbg972_11:3,818,858..3,820,648(+) | Tbg972_11:3818858..3820648(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_146568 | 0 | 596 | 1791 | 65626 | 8.59 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.16280ORPPPDE putative peptidase domain containing protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.16280 OR PPPDE putative peptidase domain containing protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.16520 | Tbg972.11.16520:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2034 | Tbg972.11.16520 | Metalloprotease M41 FtsH, putative | Metalloprotease M41 FtsH, putative | | | 11 | Tbg972_11:3,872,763..3,874,796(-) | Tbg972_11:3872763..3874796(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_134869 | 0 | 677 | 2034 | 74488 | 8.50 | 0 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0016021;GO:0005739 | integral component of membrane;mitochondrion | GO:0016887 | ATPase activity | GO:0006508 | proteolysis | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.16520ORMetalloprotease M41 FtsH, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.16520 OR Metalloprotease M41 FtsH, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.18040 | Tbg972.11.18040:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3555 | Tbg972.11.18040 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 11 | Tbg972_11:4,223,509..4,227,063(-) | Tbg972_11:4223509..4227063(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 48 | OG6_146381 | 0 | 1184 | 3555 | 131235 | 5.40 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737 | cytoplasm | GO:0004197;GO:0004221;GO:0004843 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.18040ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.18040 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.18290 | Tbg972.11.18290:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1047 | Tbg972.11.18290 | peptidase, putative | peptidase, putative | | | 11 | Tbg972_11:4,289,144..4,290,190(-) | Tbg972_11:4289144..4290190(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 97 | OG6_100501 | 1 | 348 | 1047 | 37643 | 5.31 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0008233 | peptidase activity | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.18290ORpeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.18290 OR peptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.18530 | Tbg972.11.18530:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1089 | Tbg972.11.18530 | enoyl-CoA hydratase/isomerase family protein, putative | enoyl-CoA hydratase/isomerase family protein, putative | | | 11 | Tbg972_11:4,337,118..4,338,206(-) | Tbg972_11:4337118..4338206(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 65 | OG6_102025 | 0 | 362 | 1089 | 40223 | 6.51 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | GO:0097014;GO:0005737;GO:0005739;GO:0031981 | ciliary plasm;cytoplasm;mitochondrion;nuclear lumen | GO:0003824 | catalytic activity | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.18530ORenoyl-CoA hydratase/isomerase family protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.18530 OR enoyl-CoA hydratase/isomerase family protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.2100 | Tbg972.11.2100:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1665 | Tbg972.11.2100 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 11 | Tbg972_11:540,175..541,839(+) | Tbg972_11:540175..541839(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 57 | OG6_101021 | 0 | 554 | 1665 | 63021 | 7.49 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | GO:0004197;GO:0004221;GO:0004843 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.2100ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.2100 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.2720 | Tbg972.11.2720:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1698 | Tbg972.11.2720 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | | 11 | Tbg972_11:693,388..695,085(-) | Tbg972_11:693388..695085(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_105603 | 0 | 565 | 1698 | 60612 | 7.60 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005654 | nucleoplasm | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | 3.4.11.- (Aminopeptidases.) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.2720ORmetallo-peptidase, Clan MF, Family M17ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.2720 OR metallo-peptidase, Clan MF, Family M17 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.2740 | Tbg972.11.2740:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1512 | Tbg972.11.2740 | Metallocarboxypeptidase 1 | Metallocarboxypeptidase 1 | | | 11 | Tbg972_11:703,750..705,261(-) | Tbg972_11:703750..705261(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 155 | OG6_105939 | 0 | 503 | 1512 | 57682 | 5.93 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0004181 | metallocarboxypeptidase activity | GO:0006518;GO:0006508 | peptide metabolic process;proteolysis | 3.4.17.19 (Carboxypeptidase Taq) | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.2740ORMetallocarboxypeptidase 1ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.2740 OR Metallocarboxypeptidase 1 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.3520 | Tbg972.11.3520:mRNA | 1 | 1 | 1 | | | reverse | protein coding | Yes | 618 | Tbg972.11.3520 | Der1-like family, putative | Der1-like family, putative | | | 11 | Tbg972_11:869,177..869,794(-) | Tbg972_11:869177..869794(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 0 | N/A (orthology not determined because poor protein quality) | 0 | 205 | 618 | 23857 | 9.00 | 4 | HMM: MDFNFLWEIPPVTRLLLCLSVISVVLVSFGL, NN: MDFNFLWEIPPVTRLLLCLSVISVVLVSFGL | NN Sum: 3, NN D: .63, HMM Prob: .38 | | | | | | | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.3520ORDer1-like family, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.3520 OR Der1-like family, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.4060 | Tbg972.11.4060:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2616 | Tbg972.11.4060 | metallo-peptidase, Clan MA(E) Family M1 | metallo-peptidase, Clan MA(E) Family M1 | | | 11 | Tbg972_11:1,024,715..1,027,330(+) | Tbg972_11:1024715..1027330(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 59 | OG6_100948 | 0 | 871 | 2616 | 98070 | 5.82 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | GO:0008237;GO:0004179 | metallopeptidase activity;obsolete membrane alanyl aminopeptidase activity | GO:0006508 | proteolysis | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.4060ORmetallo-peptidase, Clan MA(E) Family M1ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.4060 OR metallo-peptidase, Clan MA(E) Family M1 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.4220 | Tbg972.11.4220:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1128 | Tbg972.11.4220 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | | 11 | Tbg972_11:1,057,656..1,058,783(+) | Tbg972_11:1057656..1058783(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_101420 | 0 | 375 | 1128 | 41437 | 6.99 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.4220ORAlpha/beta hydrolase family, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.4220 OR Alpha/beta hydrolase family, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.4280 | Tbg972.11.4280:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1314 | Tbg972.11.4280 | proteasome regulatory ATPase subunit 2, putative | proteasome regulatory ATPase subunit 2, putative | | | 11 | Tbg972_11:1,073,308..1,074,621(+) | Tbg972_11:1073308..1074621(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 54 | OG6_101477 | 0 | 437 | 1314 | 48928 | 5.06 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654;GO:0005838 | cytoplasm;nucleoplasm;proteasome regulatory particle | GO:0016887 | ATPase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.4280ORproteasome regulatory ATPase subunit 2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.4280 OR proteasome regulatory ATPase subunit 2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.4340 | Tbg972.11.4340:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4464 | Tbg972.11.4340 | subtilisin peptidase | subtilisin peptidase | | | 11 | Tbg972_11:1,082,709..1,087,172(+) | Tbg972_11:1082709..1087172(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_136864 | 0 | 1487 | 4464 | 161439 | 6.49 | 1 | HMM: MTCIQENITGLLFLCCCLSLSLWVLSTCKAH, NN: MTCIQENITGLLFLCCCLSLSLWVLSTCKAH | NN Sum: 3, NN D: .62, HMM Prob: .85 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004252 | serine-type endopeptidase activity | GO:0030154;GO:0045454;GO:0009405 | cell differentiation;cell redox homeostasis;pathogenesis | | 3.4.21.112 (Site-1 protease) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.4340ORsubtilisin peptidaseANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.4340 OR subtilisin peptidase AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.4600 | Tbg972.11.4600:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1557 | Tbg972.11.4600 | mitochondrial processing peptidase alpha subunit | mitochondrial processing peptidase alpha subunit | | | 11 | Tbg972_11:1,161,788..1,163,344(+) | Tbg972_11:1161788..1163344(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_146937 | 0 | 518 | 1557 | 56964 | 7.13 | 0 | NN: MYRRAVAAAIPAVTAK, HMM: MYRRAVAAAIPAVTAKNAR | NN Sum: 0, NN D: .24, HMM Prob: .62 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005739 | mitochondrion | | | | | 3.4.99.41 (Transferred entry: 3.4.24.64) | 3.4.99.41 (Transferred entry: 3.4.24.64) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.4600ORmitochondrial processing peptidase alpha subunitANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.4600 OR mitochondrial processing peptidase alpha subunit AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.4780 | Tbg972.11.4780:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1620 | Tbg972.11.4780 | Metallopeptidase family M24, putative | Metallopeptidase family M24, putative | | | 11 | Tbg972_11:1,210,740..1,212,359(-) | Tbg972_11:1210740..1212359(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_146697 | 0 | 539 | 1620 | 59167 | 9.19 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.4780ORMetallopeptidase family M24, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.4780 OR Metallopeptidase family M24, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.5280 | Tbg972.11.5280:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3339 | Tbg972.11.5280 | calpain-like protein, putative | calpain-like protein, putative | | | 11 | Tbg972_11:1,321,186..1,324,524(+) | Tbg972_11:1321186..1324524(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_103851 | 0 | 1112 | 3339 | 123932 | 8.29 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.5280ORcalpain-like protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.5280 OR calpain-like protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.5810 | Tbg972.11.5810:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 930 | Tbg972.11.5810 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 11 | Tbg972_11:1,457,451..1,458,380(+) | Tbg972_11:1457451..1458380(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_102753 | 0 | 309 | 930 | 34599 | 4.83 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005838 | cytoplasm;proteasome regulatory particle | GO:0004221 | obsolete ubiquitin thiolesterase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.5810ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.5810 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.5950 | Tbg972.11.5950:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2298 | Tbg972.11.5950 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 11 | Tbg972_11:1,493,751..1,496,048(+) | Tbg972_11:1493751..1496048(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_101457 | 0 | 765 | 2298 | 85744 | 9.49 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005634 | nucleus | GO:0004197;GO:0004221;GO:0004843 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.5950ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.5950 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.5990 | Tbg972.11.5990:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1971 | Tbg972.11.5990 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | | 11 | Tbg972_11:1,502,851..1,504,821(+) | Tbg972_11:1502851..1504821(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 123 | OG6_101256 | 2 | 656 | 1971 | 71352 | 7.59 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.5990ORPPPDE putative peptidase domain containing protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.5990 OR PPPDE putative peptidase domain containing protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.7380 | Tbg972.11.7380:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1593 | Tbg972.11.7380 | PUF nine target 1 | PUF nine target 1 | | | 11 | Tbg972_11:1,831,611..1,833,203(-) | Tbg972_11:1831611..1833203(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 54 | OG6_146977 | 0 | 530 | 1593 | 58990 | 8.56 | 0 | HMM: MLSRAPRPNNRLIVVCSCIKNVSGW, NN: MLSRAPRPNNRLIVVCSCIKNVSGW | NN Sum: 1, NN D: .25, HMM Prob: .79 | | | | | | | GO:0020023 | kinetoplast | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.7380ORPUF nine target 1ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.7380 OR PUF nine target 1 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.7420 | Tbg972.11.7420:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1566 | Tbg972.11.7420 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | | 11 | Tbg972_11:1,843,249..1,844,814(-) | Tbg972_11:1843249..1844814(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 68 | OG6_142599 | 0 | 521 | 1566 | 55373 | 6.43 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005654 | nucleoplasm | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.7420ORmetallo-peptidase, Clan MF, Family M17ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.7420 OR metallo-peptidase, Clan MF, Family M17 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.7950 | Tbg972.11.7950:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 744 | Tbg972.11.7950 | proteasome alpha 7 subunit, putative | proteasome alpha 7 subunit, putative | | | 11 | Tbg972_11:1,967,742..1,968,485(-) | Tbg972_11:1967742..1968485(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_101207 | 0 | 247 | 744 | 27865 | 7.05 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.7950ORproteasome alpha 7 subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.7950 OR proteasome alpha 7 subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.8310 | Tbg972.11.8310:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 618 | Tbg972.11.8310 | proteasome beta 3 subunit, putative | proteasome beta 3 subunit, putative | | | 11 | Tbg972_11:2,043,532..2,044,149(+) | Tbg972_11:2043532..2044149(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_101970 | 0 | 205 | 618 | 22457 | 4.81 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005654;GO:0019774 | cytoplasm;nucleoplasm;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.8310ORproteasome beta 3 subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.8310 OR proteasome beta 3 subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.8480 | Tbg972.11.8480:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2028 | Tbg972.11.8480 | major surface protease A, putative | major surface protease A, putative | | | 11 | Tbg972_11:2,078,046..2,080,073(+) | Tbg972_11:2078046..2080073(+) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 623 | OG6_101754 | 0 | 675 | 2028 | 73344 | 6.50 | 0 | NN: MLHHKLDTVSVIALLLTLRGTAAD, HMM: MLHHKLDTVSVIALLLTLRGTAAD | NN Sum: 4, NN D: .83, HMM Prob: 1 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.8480ORmajor surface protease A, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.8480 OR major surface protease A, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.11.8840 | Tbg972.11.8840:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1335 | Tbg972.11.8840 | Gp63-1 surface protease homolog, putative | Gp63-1 surface protease homolog, putative | | | 11 | Tbg972_11:2,144,949..2,146,283(-) | Tbg972_11:2144949..2146283(-) | Tbg972_11 | Trypanosoma brucei gambiense DAL972 | 1351 | OG6_101715 | 3 | 444 | 1335 | 48370 | 5.52 | 0 | | | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.11.8840ORGp63-1 surface protease homolog, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.11.8840 OR Gp63-1 surface protease homolog, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.1300 | Tbg972.3.1300:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 909 | Tbg972.3.1300 | CAAX amino terminal protease, putative | CAAX amino terminal protease, putative | | | 3 | Tbg972_03:320,360..321,268(-) | Tbg972_03:320360..321268(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_103186 | 0 | 302 | 909 | 33915 | 8.78 | 5 | | | GO:0016020 | membrane | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.1300ORCAAX amino terminal protease, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.1300 OR CAAX amino terminal protease, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.1750 | Tbg972.3.1750:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 870 | Tbg972.3.1750 | CHAP domain containing protein, putative | CHAP domain containing protein, putative | | | 3 | Tbg972_03:405,719..406,588(-) | Tbg972_03:405719..406588(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 98 | OG6_158192 | 0 | 289 | 870 | 33286 | 9.61 | 1 | NN: MVSLNRKQKFQLAVPATLLLFLFVYVLLGGGSPQ, HMM: MVSLNRKQKFQLAVPATLLLFLFVYVLLGGGSPQ | NN Sum: 3, NN D: .59, HMM Prob: .81 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.1750ORCHAP domain containing protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.1750 OR CHAP domain containing protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.2030 | Tbg972.3.2030:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1848 | Tbg972.3.2030 | Xaa-Pro aminopeptidase, putative | Xaa-Pro aminopeptidase, putative | | | 3 | Tbg972_03:471,372..473,219(-) | Tbg972_03:471372..473219(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 61 | OG6_100896 | 0 | 615 | 1848 | 68469 | 5.99 | 0 | | | | | GO:0016787 | hydrolase activity | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.2030ORXaa-Pro aminopeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.2030 OR Xaa-Pro aminopeptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.2400 | Tbg972.3.2400:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 381 | Tbg972.3.2400 | Microsomal signal peptidase 12 kDa subunit (SPC12), putative | Microsomal signal peptidase 12 kDa subunit (SPC12), putative | | | 3 | Tbg972_03:531,509..531,889(+) | Tbg972_03:531509..531889(+) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 43 | OG6_147500 | 0 | 126 | 381 | 14221 | 6.25 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.2400ORMicrosomal signal peptidase 12 kDa subunit (SPC12), putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.2400 OR Microsomal signal peptidase 12 kDa subunit (SPC12), putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.3070 | Tbg972.3.3070:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 609 | Tbg972.3.3070 | hypothetical protein, conserved | hypothetical protein, conserved | | | 3 | Tbg972_03:689,358..689,966(-) | Tbg972_03:689358..689966(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 47 | OG6_158140 | 0 | 202 | 609 | 21657 | 6.50 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.3070ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.3070 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.3570 | Tbg972.3.3570:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1356 | Tbg972.3.3570 | aspartyl aminopeptidase, putative | aspartyl aminopeptidase, putative | | | 3 | Tbg972_03:793,193..794,548(-) | Tbg972_03:793193..794548(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_102047 | 0 | 451 | 1356 | 49268 | 6.83 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0031514 | cytoplasm;motile cilium | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.3570ORaspartyl aminopeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.3570 OR aspartyl aminopeptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.400 | Tbg972.3.400:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 714 | Tbg972.3.400 | proteasome alpha 7 subunit | proteasome alpha 7 subunit | | | 3 | Tbg972_03:113,368..114,081(-) | Tbg972_03:113368..114081(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_102011 | 0 | 237 | 714 | 25462 | 5.57 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654;GO:0019773 | cytoplasm;nucleoplasm;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.400ORproteasome alpha 7 subunitANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.400 OR proteasome alpha 7 subunit AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.5310 | Tbg972.3.5310:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2616 | Tbg972.3.5310 | Aminopeptidase M1, putative | Aminopeptidase M1, putative | | | 3 | Tbg972_03:1,212,453..1,215,068(-) | Tbg972_03:1212453..1215068(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 59 | OG6_137617 | 1 | 871 | 2616 | 97252 | 5.69 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.5310ORAminopeptidase M1, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.5310 OR Aminopeptidase M1, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.5350 | Tbg972.3.5350:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2616 | Tbg972.3.5350 | Aminopeptidase M1, putative | Aminopeptidase M1, putative | | | 3 | Tbg972_03:1,222,474..1,225,089(-) | Tbg972_03:1222474..1225089(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 59 | OG6_137617 | 1 | 871 | 2616 | 97252 | 5.69 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.5350ORAminopeptidase M1, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.5350 OR Aminopeptidase M1, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.5420 | Tbg972.3.5420:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2196 | Tbg972.3.5420 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 3 | Tbg972_03:1,234,687..1,236,882(-) | Tbg972_03:1234687..1236882(-) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_101380 | 0 | 731 | 2196 | 81751 | 5.81 | 0 | | | | | GO:0004843;GO:0036459;GO:0008270 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | GO:0005654 | nucleoplasm | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.5420ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.5420 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.5500 | Tbg972.3.5500:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1059 | Tbg972.3.5500 | signal peptide peptidase, putative | signal peptide peptidase, putative | | | 3 | Tbg972_03:1,250,352..1,251,410(+) | Tbg972_03:1250352..1251410(+) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_102328 | 0 | 352 | 1059 | 38635 | 4.74 | 8 | HMM: MPSPSETIQLSIALAYLMASAV, NN: MPSPSETIQLSIALAYLMASAV | NN Sum: 4, NN D: .53, HMM Prob: .48 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.5500ORsignal peptide peptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.5500 OR signal peptide peptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.3.6320 | Tbg972.3.6320:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2862 | Tbg972.3.6320 | Metallopeptidase family M24/FACT complex subunit (SPT16/CDC68)/Histone chaperone Rttp106-like, putative | Metallopeptidase family M24/FACT complex subunit (SPT16/CDC68)/Histone chaperone Rttp106-like, putative | | | 3 | Tbg972_03:1,446,239..1,449,100(+) | Tbg972_03:1446239..1449100(+) | Tbg972_03 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_102309 | 0 | 953 | 2862 | 105749 | 5.01 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.3.6320ORMetallopeptidase family M24/FACT complex subunit (SPT16/CDC68)/Histone chaperone Rttp106-like, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.3.6320 OR Metallopeptidase family M24/FACT complex subunit (SPT16/CDC68)/Histone chaperone Rttp106-like, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.170 | Tbg972.4.170:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 657 | Tbg972.4.170 | proteasome beta 7 subunit, putative | proteasome beta 7 subunit, putative | | | 4 | Tbg972_04:49,192..49,848(-) | Tbg972_04:49192..49848(-) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 62 | OG6_101718 | 0 | 218 | 657 | 24408 | 6.35 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.170ORproteasome beta 7 subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.170 OR proteasome beta 7 subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.1750 | Tbg972.4.1750:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2322 | Tbg972.4.1750 | Carboxypeptidase-like protein | Carboxypeptidase-like protein | | | 4 | Tbg972_04:376,319..378,640(-) | Tbg972_04:376319..378640(-) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_105780 | 0 | 773 | 2322 | 84260 | 8.17 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0043531;GO:0005524;GO:0004181;GO:0008270 | ADP binding;ATP binding;metallocarboxypeptidase activity;zinc ion binding | | | 3.4.17.- (Metallocarboxypeptidases.) | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.1750ORCarboxypeptidase-like proteinANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.1750 OR Carboxypeptidase-like protein AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.2640 | Tbg972.4.2640:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 669 | Tbg972.4.2640 | pyroglutamyl-peptidase I, putative | pyroglutamyl-peptidase I, putative | | | 4 | Tbg972_04:672,037..672,705(+) | Tbg972_04:672037..672705(+) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 48 | OG6_101530 | 0 | 222 | 669 | 25118 | 5.78 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0016920 | pyroglutamyl-peptidase activity | | | | 3.4.19.3 (Pyroglutamyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.2640ORpyroglutamyl-peptidase I, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.2640 OR pyroglutamyl-peptidase I, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.3310 | Tbg972.4.3310:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2160 | Tbg972.4.3310 | mitochondrial ATP-dependent zinc metallopeptidase, putative | mitochondrial ATP-dependent zinc metallopeptidase, putative | | | 4 | Tbg972_04:822,436..824,595(-) | Tbg972_04:822436..824595(-) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_100384 | 0 | 719 | 2160 | 78872 | 8.89 | 1 | NN: MFRIPRSAHLSFAAAALQTSKCFCA, HMM: MFRIPRSAHLSFAAAALQTSKCF | NN Sum: 2, NN D: .38, HMM Prob: .98 | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.3310ORmitochondrial ATP-dependent zinc metallopeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.3310 OR mitochondrial ATP-dependent zinc metallopeptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.3850 | Tbg972.4.3850:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1398 | Tbg972.4.3850 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 4 | Tbg972_04:946,857..948,254(-) | Tbg972_04:946857..948254(-) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 58 | OG6_101892 | 0 | 465 | 1398 | 52018 | 6.63 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.3850ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.3850 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.4050 | Tbg972.4.4050:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2379 | Tbg972.4.4050 | Calpain-like protein 2 | Calpain-like protein 2 | | | 4 | Tbg972_04:1,009,675..1,012,053(-) | Tbg972_04:1009675..1012053(-) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_156861 | 0 | 792 | 2379 | 89727 | 5.51 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.4050ORCalpain-like protein 2ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.4050 OR Calpain-like protein 2 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.4060 | Tbg972.4.4060:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2562 | Tbg972.4.4060 | cytoskeleton-associated protein CAP5.5, putative | cytoskeleton-associated protein CAP5.5, putative | | | 4 | Tbg972_04:1,014,877..1,017,438(-) | Tbg972_04:1014877..1017438(-) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 56 | OG6_143858 | 1 | 853 | 2562 | 94695 | 4.15 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0036064;GO:0020016;GO:0030863;GO:0020038 | ciliary basal body;ciliary pocket;cortical cytoskeleton;subpellicular network | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.4060ORcytoskeleton-associated protein CAP5.5, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.4060 OR cytoskeleton-associated protein CAP5.5, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.4450 | Tbg972.4.4450:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 933 | Tbg972.4.4450 | monoglyceride lipase, putative | monoglyceride lipase, putative | | | 4 | Tbg972_04:1,101,088..1,102,020(-) | Tbg972_04:1101088..1102020(-) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 80 | OG6_100231 | 1 | 310 | 933 | 35004 | 6.43 | 0 | | | | | | | | | GO:0005737;GO:0020015 | cytoplasm;glycosome | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.4450ORmonoglyceride lipase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.4450 OR monoglyceride lipase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.4.500 | Tbg972.4.500:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1479 | Tbg972.4.500 | Peptidase family C78, putative | Peptidase family C78, putative | | | 4 | Tbg972_04:125,307..126,785(-) | Tbg972_04:125307..126785(-) | Tbg972_04 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_102601 | 0 | 492 | 1479 | 54988 | 6.24 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.4.500ORPeptidase family C78, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.4.500 OR Peptidase family C78, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.1430 | Tbg972.5.1430:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1470 | Tbg972.5.1430 | mitochondrial processing peptidase, beta subunit, putative | mitochondrial processing peptidase, beta subunit, putative | | | 5 | Tbg972_05:312,891..314,360(+) | Tbg972_05:312891..314360(+) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_137602 | 0 | 489 | 1470 | 54121 | 6.94 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005737;GO:0005739 | cytoplasm;mitochondrion | GO:0004240 | obsolete mitochondrial processing peptidase activity | GO:0006508 | proteolysis | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.1430ORmitochondrial processing peptidase, beta subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.1430 OR mitochondrial processing peptidase, beta subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.1460 | Tbg972.5.1460:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2748 | Tbg972.5.1460 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | | 5 | Tbg972_05:315,817..318,564(+) | Tbg972_05:315817..318564(+) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_124705 | 0 | 915 | 2748 | 101545 | 7.31 | 0 | | | | | | | | | GO:0051286 | cell tip | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.1460OROTU-like cysteine protease, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.1460 OR OTU-like cysteine protease, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.2080 | Tbg972.5.2080:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1428 | Tbg972.5.2080 | ATP-dependent protease ATPase subunit HslU1, putative | ATP-dependent protease ATPase subunit HslU1, putative | | | 5 | Tbg972_05:440,157..441,584(-) | Tbg972_05:440157..441584(-) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_106348 | 0 | 475 | 1428 | 52530 | 8.62 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0009376;GO:0005737;GO:0042645 | HslUV protease complex;cytoplasm;mitochondrial nucleoid | | | GO:0006264;GO:0070581 | mitochondrial DNA replication;rolling circle DNA replication | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.2080ORATP-dependent protease ATPase subunit HslU1, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.2080 OR ATP-dependent protease ATPase subunit HslU1, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.3400 | Tbg972.5.3400:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2961 | Tbg972.5.3400 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | | | 5 | Tbg972_05:704,500..707,460(+) | Tbg972_05:704500..707460(+) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 22 | OG6_215198 | 0 | 986 | 2961 | 108196 | 6.47 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005634 | nucleus | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.3400ORPeptidase C19, ubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.3400 OR Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.3420 | Tbg972.5.3420:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4020 | Tbg972.5.3420 | kinesin, putative | kinesin, putative | | | 5 | Tbg972_05:710,589..714,608(+) | Tbg972_05:710589..714608(+) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 54 | OG6_146515 | 0 | 1339 | 4020 | 149642 | 6.31 | 0 | | | | | GO:0005524;GO:0005488;GO:0008017;GO:0003777;GO:0005515 | ATP binding;binding;microtubule binding;microtubule motor activity;protein binding | GO:0007018 | microtubule-based movement | GO:0005930;GO:0097542 | axoneme;ciliary tip | | | GO:0010608 | posttranscriptional regulation of gene expression | | 3.6.4.4 (Transferred entry: 5.6.1.3) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.3420ORkinesin, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.3420 OR kinesin, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.3620 | Tbg972.5.3620:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2091 | Tbg972.5.3620 | eukaryotic translation initiation factor 3 subunit b | eukaryotic translation initiation factor 3 subunit b | | | 5 | Tbg972_05:771,410..773,500(+) | Tbg972_05:771410..773500(+) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 55 | OG6_101924 | 0 | 696 | 2091 | 79839 | 9.36 | 0 | | | | | | | | | GO:0005737;GO:0005852 | cytoplasm;eukaryotic translation initiation factor 3 complex | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.3620OReukaryotic translation initiation factor 3 subunit bANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.3620 OR eukaryotic translation initiation factor 3 subunit b AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.3790 | Tbg972.5.3790:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 807 | Tbg972.5.3790 | otubain cysteine peptidase, Clan CA, family C65, putative | otubain cysteine peptidase, Clan CA, family C65, putative | | | 5 | Tbg972_05:802,475..803,281(+) | Tbg972_05:802475..803281(+) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_102549 | 0 | 268 | 807 | 30425 | 4.62 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.3790ORotubain cysteine peptidase, Clan CA, family C65, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.3790 OR otubain cysteine peptidase, Clan CA, family C65, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.4490 | Tbg972.5.4490:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 627 | Tbg972.5.4490 | signal peptidase type I, putative | signal peptidase type I, putative | | | 5 | Tbg972_05:945,772..946,398(-) | Tbg972_05:945772..946398(-) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 48 | OG6_100807 | 0 | 208 | 627 | 23705 | 8.11 | 0 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.4490ORsignal peptidase type I, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.4490 OR signal peptidase type I, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.5.4800 | Tbg972.5.4800:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1587 | Tbg972.5.4800 | ABC1 family, putative | ABC1 family, putative | | | 5 | Tbg972_05:1,025,263..1,026,849(-) | Tbg972_05:1025263..1026849(-) | Tbg972_05 | Trypanosoma brucei gambiense DAL972 | 108 | OG6_100510 | 1 | 528 | 1587 | 59882 | 8.94 | 1 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.5.4800ORABC1 family, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.5.4800 OR ABC1 family, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.1070 | Tbg972.6.1070:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2310 | Tbg972.6.1070 | hypothetical protein, conserved | hypothetical protein, conserved | | | 6 | Tbg972_06:283,258..285,567(-) | Tbg972_06:283258..285567(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_134892 | 0 | 769 | 2310 | 87827 | 6.03 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.1070ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.1070 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.1360 | Tbg972.6.1360:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3255 | Tbg972.6.1360 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | | 6 | Tbg972_06:337,603..340,857(-) | Tbg972_06:337603..340857(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_102772 | 0 | 1084 | 3255 | 121019 | 6.35 | 0 | | | | | GO:0005515 | protein binding | | | | | | | GO:0000289;GO:0010608 | nuclear-transcribed mRNA poly(A) tail shortening;posttranscriptional regulation of gene expression | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.1360ORubiquitin hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.1360 OR ubiquitin hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.1380 | Tbg972.6.1380:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 984 | Tbg972.6.1380 | cysteine peptidase, Clan CA, family C54, putative | cysteine peptidase, Clan CA, family C54, putative | | | 6 | Tbg972_06:344,284..345,267(-) | Tbg972_06:344284..345267(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 97 | OG6_100501 | 1 | 327 | 984 | 36418 | 6.87 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.1380ORcysteine peptidase, Clan CA, family C54, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.1380 OR cysteine peptidase, Clan CA, family C54, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.1510 | Tbg972.6.1510:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1242 | Tbg972.6.1510 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | | 6 | Tbg972_06:379,347..380,588(-) | Tbg972_06:379347..380588(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 48 | OG6_105308 | 0 | 413 | 1242 | 46084 | 4.67 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.1510ORAlpha/beta hydrolase family, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.1510 OR Alpha/beta hydrolase family, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.1980 | Tbg972.6.1980:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 594 | Tbg972.6.1980 | DJ-1 family protein, putative | DJ-1 family protein, putative | | | 6 | Tbg972_06:470,909..471,502(+) | Tbg972_06:470909..471502(+) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 48 | OG6_101257 | 0 | 197 | 594 | 21125 | 5.96 | 0 | | | | | | | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.1980ORDJ-1 family protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.1980 OR DJ-1 family protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.220 | Tbg972.6.220:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1023 | Tbg972.6.220 | cysteine peptidase C (CPC), putative | cysteine peptidase C (CPC), putative | | | 6 | Tbg972_06:47,059..48,081(-) | Tbg972_06:47059..48081(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 79 | OG6_101151 | 0 | 340 | 1023 | 37283 | 5.84 | 1 | NN: MHLMRACITFYIASTAVVAVNAA, HMM: MHLMRACITFYIASTAVVAVNAA | NN Sum: 4, NN D: .71, HMM Prob: .95 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | GO:0010608 | posttranscriptional regulation of gene expression | 3.4.22.2 (Papain) | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.220ORcysteine peptidase C (CPC), putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.220 OR cysteine peptidase C (CPC), putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.3100 | Tbg972.6.3100:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3033 | Tbg972.6.3100 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 6 | Tbg972_06:744,833..747,865(+) | Tbg972_06:744833..747865(+) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_146872 | 0 | 1010 | 3033 | 113406 | 5.84 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930 | axoneme | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.3100ORcysteine peptidase, Clan CA, family C2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.3100 OR cysteine peptidase, Clan CA, family C2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.4190 | Tbg972.6.4190:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1269 | Tbg972.6.4190 | Protein of unknown function (DUF544), putative | Protein of unknown function (DUF544), putative | | | 6 | Tbg972_06:1,002,461..1,003,729(-) | Tbg972_06:1002461..1003729(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 24 | OG6_102202 | 0 | 422 | 1269 | 46522 | 4.64 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.4190ORProtein of unknown function (DUF544), putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.4190 OR Protein of unknown function (DUF544), putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.700 | Tbg972.6.700:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1074 | Tbg972.6.700 | metacaspase MCA3 | metacaspase MCA3 | | | 6 | Tbg972_06:195,221..196,294(-) | Tbg972_06:195221..196294(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 154 | OG6_101407 | 4 | 357 | 1074 | 38624 | 5.67 | 0 | HMM: MAVDPRCLLSLCSTISKASSA, NN: MAVDPRCLLSLCSTISKASSA | NN Sum: 1, NN D: .26, HMM Prob: .93 | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.700ORmetacaspase MCA3ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.700 OR metacaspase MCA3 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.710 | Tbg972.6.710:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1044 | Tbg972.6.710 | metacaspase MCA2, putative | metacaspase MCA2, putative | | | 6 | Tbg972_06:198,082..199,125(-) | Tbg972_06:198082..199125(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 154 | OG6_101407 | 4 | 347 | 1044 | 37793 | 5.90 | 0 | | | | | | | | | GO:0005634 | nucleus | GO:0008233 | peptidase activity | GO:0009060;GO:0006508 | aerobic respiration;proteolysis | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.710ORmetacaspase MCA2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.710 OR metacaspase MCA2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.725 | Tbg972.6.725:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1356 | Tbg972.6.725 | cysteine peptidase, Clan CA, family C1, Cathepsin L-like | cysteine peptidase, Clan CA, family C1, Cathepsin L-like | | | 6 | Tbg972_06:202,711..204,066(-) | Tbg972_06:202711..204066(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 543 | OG6_100116 | 5 | 451 | 1356 | 48555 | 5.26 | 1 | NN: MPRTEMVRFVRLPVVLLAMAACLASVALGS, HMM: MPRTEMVRFVRLPVVLLAMAACLASVALGS | NN Sum: 3, NN D: .63, HMM Prob: .99 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.725ORcysteine peptidase, Clan CA, family C1, Cathepsin L-likeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.725 OR cysteine peptidase, Clan CA, family C1, Cathepsin L-like AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.730 | Tbg972.6.730:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 660 | Tbg972.6.730 | cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) | cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) | | | 6 | Tbg972_06:205,215..205,874(-) | Tbg972_06:205215..205874(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 543 | OG6_100116 | 5 | 220 | 660 | 24246 | 8.46 | 1 | NN: MPRTEMVRFVRLPVVLLAMAACLASVALGS, HMM: MPRTEMVRFVRLPVVLLAMAACLASVALGS | NN Sum: 3, NN D: .63, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.730ORcysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment)ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.730 OR cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.735 | Tbg972.6.735:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1353 | Tbg972.6.735 | cysteine peptidase, Clan CA, family C1, Cathepsin L-like | cysteine peptidase, Clan CA, family C1, Cathepsin L-like | | | 6 | Tbg972_06:206,288..207,640(-) | Tbg972_06:206288..207640(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 543 | OG6_100116 | 5 | 450 | 1353 | 48458 | 5.26 | 1 | HMM: MPRTEMVRFVRLPVVLLAMAACLASVALGS, NN: MPRTEMVRFVRLPVVLLAMAACLASVALGS | NN Sum: 3, NN D: .63, HMM Prob: .99 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.735ORcysteine peptidase, Clan CA, family C1, Cathepsin L-likeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.735 OR cysteine peptidase, Clan CA, family C1, Cathepsin L-like AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.740 | Tbg972.6.740:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1215 | Tbg972.6.740 | cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) | cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) | | | 6 | Tbg972_06:208,053..209,267(-) | Tbg972_06:208053..209267(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 543 | OG6_100116 | 5 | 404 | 1215 | 43453 | 4.75 | 0 | | | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.740ORcysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment)ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.740 OR cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.750 | Tbg972.6.750:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 603 | Tbg972.6.750 | cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) | cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) | | | 6 | Tbg972_06:209,372..209,974(-) | Tbg972_06:209372..209974(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 543 | OG6_100116 | 5 | 201 | 603 | 22287 | 8.73 | 1 | NN: MPRTEMVRFVRLPVVLLAMAACLASVALGS, HMM: MPRTEMVRFVRLPVVLLAMAACLASVALGS | NN Sum: 3, NN D: .63, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.750ORcysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment)ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.750 OR cysteine peptidase, Clan CA, family C1, Cathepsin L-like, (fragment) AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.760 | Tbg972.6.760:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1353 | Tbg972.6.760 | cysteine peptidase, Clan CA, family C1, Cathepsin L-like | cysteine peptidase, Clan CA, family C1, Cathepsin L-like | | | 6 | Tbg972_06:210,387..211,739(-) | Tbg972_06:210387..211739(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 543 | OG6_100116 | 5 | 450 | 1353 | 48458 | 5.26 | 1 | NN: MPRTEMVRFVRLPVVLLAMAACLASVALGS, HMM: MPRTEMVRFVRLPVVLLAMAACLASVALGS | NN Sum: 3, NN D: .63, HMM Prob: .99 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.760ORcysteine peptidase, Clan CA, family C1, Cathepsin L-likeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.760 OR cysteine peptidase, Clan CA, family C1, Cathepsin L-like AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.790 | Tbg972.6.790:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1212 | Tbg972.6.790 | proteasome regulatory ATPase subunit 3, putative | proteasome regulatory ATPase subunit 3, putative | | | 6 | Tbg972_06:217,947..219,158(-) | Tbg972_06:217947..219158(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_101965 | 0 | 403 | 1212 | 44858 | 7.29 | 0 | HMM: MTSLLAQTTNAAVAGGTPAA, NN: MTSLLAQTTNAAVAGGTPAA | NN Sum: 0, NN D: .21, HMM Prob: .55 | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005838 | proteasome regulatory particle | GO:0016887 | ATPase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.790ORproteasome regulatory ATPase subunit 3, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.790 OR proteasome regulatory ATPase subunit 3, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.80 | Tbg972.6.80:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1428 | Tbg972.6.80 | peptidase M20/M25/M40, putative | peptidase M20/M25/M40, putative | | | 6 | Tbg972_06:14,690..16,117(+) | Tbg972_06:14690..16117(+) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 94 | OG6_100503 | 1 | 475 | 1428 | 52242 | 5.92 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.80ORpeptidase M20/M25/M40, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.80 OR peptidase M20/M25/M40, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.810 | Tbg972.6.810:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3201 | Tbg972.6.810 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 6 | Tbg972_06:223,371..226,571(-) | Tbg972_06:223371..226571(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 21 | OG6_105906 | 0 | 1066 | 3201 | 116238 | 6.04 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.810ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.810 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.6.970 | Tbg972.6.970:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 849 | Tbg972.6.970 | proteasome beta-1 subunit, putative | proteasome beta-1 subunit, putative | | | 6 | Tbg972_06:259,414..260,262(-) | Tbg972_06:259414..260262(-) | Tbg972_06 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_101390 | 0 | 282 | 849 | 30441 | 6.88 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0019774 | ciliary plasm;cytoplasm;proteasome core complex, beta-subunit complex | GO:0045024 | obsolete peptidyl-glutamyl peptide hydrolyzing enzyme activity | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.6.970ORproteasome beta-1 subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.6.970 OR proteasome beta-1 subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.2790 | Tbg972.7.2790:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1314 | Tbg972.7.2790 | proteasome regulatory ATPase subunit 1 | proteasome regulatory ATPase subunit 1 | | | 7 | Tbg972_07:709,994..711,307(-) | Tbg972_07:709994..711307(-) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_101899 | 0 | 437 | 1314 | 48475 | 7.89 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.2790ORproteasome regulatory ATPase subunit 1ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.2790 OR proteasome regulatory ATPase subunit 1 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.2860 | Tbg972.7.2860:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1338 | Tbg972.7.2860 | proteasome regulatory ATPase subunit 5 | proteasome regulatory ATPase subunit 5 | | | 7 | Tbg972_07:721,015..722,352(-) | Tbg972_07:721015..722352(-) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_101915 | 0 | 445 | 1338 | 49149 | 5.61 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.2860ORproteasome regulatory ATPase subunit 5ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.2860 OR proteasome regulatory ATPase subunit 5 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.4990 | Tbg972.7.4990:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 861 | Tbg972.7.4990 | proteasome alpha 3 subunit, putative | proteasome alpha 3 subunit, putative | | | 7 | Tbg972_07:1,243,877..1,244,737(-) | Tbg972_07:1243877..1244737(-) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_101968 | 0 | 286 | 861 | 32153 | 5.26 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654;GO:0019773 | cytoplasm;nucleoplasm;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.4990ORproteasome alpha 3 subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.4990 OR proteasome alpha 3 subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.5470 | Tbg972.7.5470:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 777 | Tbg972.7.5470 | proteasome beta 6 subunit | proteasome beta 6 subunit | | | 7 | Tbg972_07:1,335,200..1,335,976(-) | Tbg972_07:1335200..1335976(-) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_101631 | 0 | 258 | 777 | 28715 | 7.00 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.5470ORproteasome beta 6 subunitANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.5470 OR proteasome beta 6 subunit AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.5670 | Tbg972.7.5670:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2715 | Tbg972.7.5670 | serine peptidase, clan SC, family S9A-like protein | serine peptidase, clan SC, family S9A-like protein | | | 7 | Tbg972_07:1,370,361..1,373,075(-) | Tbg972_07:1370361..1373075(-) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 107 | OG6_102873 | 1 | 904 | 2715 | 104310 | 6.59 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.5670ORserine peptidase, clan SC, family S9A-like proteinANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.5670 OR serine peptidase, clan SC, family S9A-like protein AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.6870 | Tbg972.7.6870:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 351 | Tbg972.7.6870 | Autophagy-related protein 8.1 | Autophagy-related protein 8.1 | | | 7 | Tbg972_07:1,649,340..1,649,690(+) | Tbg972_07:1649340..1649690(+) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 65 | OG6_100707 | 1 | 116 | 351 | 13283 | 8.20 | 0 | | | | | | | | | GO:0005776;GO:0005737;GO:0000407 | autophagosome;cytoplasm;phagophore assembly site | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.6870ORAutophagy-related protein 8.1ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.6870 OR Autophagy-related protein 8.1 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.6890 | Tbg972.7.6890:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 363 | Tbg972.7.6890 | Autophagy-related protein 8.2 | Autophagy-related protein 8.2 | | | 7 | Tbg972_07:1,650,975..1,651,337(+) | Tbg972_07:1650975..1651337(+) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 65 | OG6_100707 | 1 | 120 | 363 | 13751 | 7.33 | 0 | | | | | | | | | GO:0005776;GO:0005737;GO:0000407 | autophagosome;cytoplasm;phagophore assembly site | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.6890ORAutophagy-related protein 8.2ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.6890 OR Autophagy-related protein 8.2 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.70 | Tbg972.7.70:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2232 | Tbg972.7.70 | thimet oligopeptidase A, putative | thimet oligopeptidase A, putative | | | 7 | Tbg972_07:14,384..16,615(+) | Tbg972_07:14384..16615(+) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 120 | OG6_100561 | 0 | 743 | 2232 | 83897 | 6.37 | 1 | HMM: MCSCLVSSWGLLIGSFLSLVSCF, NN: MCSCLVSSWGLLIGSFLSLVSCF | NN Sum: 3, NN D: .64, HMM Prob: .25 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.70ORthimet oligopeptidase A, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.70 OR thimet oligopeptidase A, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.7240 | Tbg972.7.7240:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1263 | Tbg972.7.7240 | peptidase t, putative | peptidase t, putative | | | 7 | Tbg972_07:1,744,181..1,745,443(-) | Tbg972_07:1744181..1745443(-) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_111055 | 0 | 420 | 1263 | 46262 | 4.73 | 0 | | | GO:0005737 | cytoplasm | GO:0016787;GO:0045148;GO:0008270 | hydrolase activity;tripeptide aminopeptidase activity;zinc ion binding | GO:0008152;GO:0006518 | metabolic process;peptide metabolic process | | | | | | | 3.4.11.14 (Cytosol alanyl aminopeptidase) | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.7240ORpeptidase t, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.7240 OR peptidase t, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.7480 | Tbg972.7.7480:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1119 | Tbg972.7.7480 | metallo-peptidase, Clan MK, Family M67 | metallo-peptidase, Clan MK, Family M67 | | | 7 | Tbg972_07:1,803,819..1,804,937(+) | Tbg972_07:1803819..1804937(+) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 55 | OG6_100288 | 0 | 372 | 1119 | 40201 | 6.96 | 0 | | | | | | | | | | | | | | | 3.4.24.57 (O-sialoglycoprotein endopeptidase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.7480ORmetallo-peptidase, Clan MK, Family M67ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.7480 OR metallo-peptidase, Clan MK, Family M67 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.7.8140 | Tbg972.7.8140:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2244 | Tbg972.7.8140 | glutaminyl cyclase, putative | glutaminyl cyclase, putative | | | 7 | Tbg972_07:2,016,353..2,018,596(-) | Tbg972_07:2016353..2018596(-) | Tbg972_07 | Trypanosoma brucei gambiense DAL972 | 55 | OG6_151075 | 0 | 747 | 2244 | 84132 | 10.28 | 1 | | | | | | | | | | | | | | | 2.3.2.5 (Glutaminyl-peptide cyclotransferase) | 2.3.2.5 (Glutaminyl-peptide cyclotransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.7.8140ORglutaminyl cyclase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.7.8140 OR glutaminyl cyclase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.1230 | Tbg972.8.1230:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1746 | Tbg972.8.1230 | metallopeptidase, putative | metallopeptidase, putative | | | 8 | Tbg972_08:393,983..395,728(+) | Tbg972_08:393983..395728(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 1351 | OG6_101715 | 3 | 581 | 1746 | 62950 | 5.48 | 2 | HMM: MFNTVTDVTLLFSLFPLFLPCMKRKRLMVLPACVIPMHGALKLAILLMLVWCCSLCLAK, NN: MFNTVTDVTLLFSLFPLFLPCMKRKRLMVLPACVIPMHGALKLAILLMLVWCCSLCLAK | NN Sum: 3, NN D: .49, HMM Prob: .79 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.1230ORmetallopeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.1230 OR metallopeptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.1490 | Tbg972.8.1490:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3093 | Tbg972.8.1490 | pitrilysin-like metalloprotease, putative | pitrilysin-like metalloprotease, putative | | | 8 | Tbg972_08:456,933..460,025(-) | Tbg972_08:456933..460025(-) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_101809 | 0 | 1030 | 3093 | 114354 | 6.49 | 0 | NN: MIRRCAVPLCAASAMPRGGHPL, HMM: MIRRCAVPLCAASAMPRGGHPL | NN Sum: 1, NN D: .25, HMM Prob: .68 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.1490ORpitrilysin-like metalloprotease, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.1490 OR pitrilysin-like metalloprotease, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.150 | Tbg972.8.150:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 996 | Tbg972.8.150 | proteasome regulatory non-ATP-ase subunit 10, putative | proteasome regulatory non-ATP-ase subunit 10, putative | | | 8 | Tbg972_08:46,459..47,454(-) | Tbg972_08:46459..47454(-) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_102002 | 0 | 331 | 996 | 35747 | 4.31 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0005654;GO:0000502;GO:0005838 | ciliary plasm;cytoplasm;nucleoplasm;proteasome complex;proteasome regulatory particle | GO:0005515 | protein binding | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.150ORproteasome regulatory non-ATP-ase subunit 10, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.150 OR proteasome regulatory non-ATP-ase subunit 10, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.1550 | Tbg972.8.1550:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1185 | Tbg972.8.1550 | metallo- peptidase, Clan MH, Family M18 | metallo- peptidase, Clan MH, Family M18 | | | 8 | Tbg972_08:469,056..470,240(-) | Tbg972_08:469056..470240(-) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 698 | OG6_100626 | 0 | 394 | 1185 | 43253 | 5.95 | 0 | | | GO:0005737 | cytoplasm | GO:0008777;GO:0016787 | acetylornithine deacetylase activity;hydrolase activity | GO:0006526;GO:0008152 | arginine biosynthetic process;metabolic process | GO:0020015 | glycosome | | | | | 3.5.1.16 (Acetylornithine deacetylase) | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.1550ORmetallo- peptidase, Clan MH, Family M18ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.1550 OR metallo- peptidase, Clan MH, Family M18 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.1860 | Tbg972.8.1860:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 714 | Tbg972.8.1860 | trypanothione synthetase, putative | trypanothione synthetase, putative | | | 8 | Tbg972_08:534,837..535,550(+) | Tbg972_08:534837..535550(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 20 | OG6_196855 | 0 | 237 | 714 | 26828 | 7.45 | 0 | | | | | | | | | | | | | | | 6.3.1.9 (Trypanothione synthase) | 6.3.1.9 (Trypanothione synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.1860ORtrypanothione synthetase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.1860 OR trypanothione synthetase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.2770 | Tbg972.8.2770:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2016 | Tbg972.8.2770 | metallo-peptidase, Clan MF, Family M17, putative | metallo-peptidase, Clan MF, Family M17, putative | | | 8 | Tbg972_08:730,304..732,319(+) | Tbg972_08:730304..732319(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_100682 | 0 | 671 | 2016 | 71484 | 9.88 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0030863 | cortical cytoskeleton | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.2770ORmetallo-peptidase, Clan MF, Family M17, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.2770 OR metallo-peptidase, Clan MF, Family M17, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.4680 | Tbg972.8.4680:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3615 | Tbg972.8.4680 | hypothetical protein, conserved | hypothetical protein, conserved | | | 8 | Tbg972_08:1,225,493..1,229,107(-) | Tbg972_08:1225493..1229107(-) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_102663 | 0 | 1204 | 3615 | 136552 | 6.92 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005930;GO:0005737 | axoneme;cytoplasm | | | GO:0060285 | cilium-dependent cell motility | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.4680ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.4680 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.4860 | Tbg972.8.4860:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2241 | Tbg972.8.4860 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | | 8 | Tbg972_08:1,280,879..1,283,119(+) | Tbg972_08:1280879..1283119(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 22 | OG6_143271 | 0 | 746 | 2241 | 80962 | 9.43 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.4860OROTU-like cysteine protease, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.4860 OR OTU-like cysteine protease, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.5620 | Tbg972.8.5620:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4260 | Tbg972.8.5620 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 8 | Tbg972_08:1,453,116..1,457,375(+) | Tbg972_08:1453116..1457375(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 54 | OG6_154037 | 0 | 1419 | 4260 | 158731 | 6.95 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0031981;GO:0005634 | cytoplasm;nuclear lumen;nucleus | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.5620ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.5620 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.5740 | Tbg972.8.5740:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 669 | Tbg972.8.5740 | proteasome 26S non-ATPase subunit 9, putative | proteasome 26S non-ATPase subunit 9, putative | | | 8 | Tbg972_08:1,483,755..1,484,423(+) | Tbg972_08:1483755..1484423(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_102356 | 0 | 222 | 669 | 25090 | 4.98 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.5740ORproteasome 26S non-ATPase subunit 9, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.5740 OR proteasome 26S non-ATPase subunit 9, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.7240 | Tbg972.8.7240:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3195 | Tbg972.8.7240 | peptidase, putative | peptidase, putative | | | 8 | Tbg972_08:1,802,167..1,805,361(+) | Tbg972_08:1802167..1805361(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 59 | OG6_100422 | 0 | 1064 | 3195 | 118843 | 4.83 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.7240ORpeptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.7240 OR peptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.7320 | Tbg972.8.7320:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 6546 | Tbg972.8.7320 | acetyl-CoA carboxylase | acetyl-CoA carboxylase | | | 8 | Tbg972_08:1,824,140..1,830,685(+) | Tbg972_08:1824140..1830685(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 74 | OG6_101052 | 0 | 2181 | 6546 | 242941 | 6.59 | 0 | | | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | GO:0009343;GO:0005737;GO:0020015 | biotin carboxylase complex;cytoplasm;glycosome | GO:0005524;GO:0003989;GO:0004075 | ATP binding;acetyl-CoA carboxylase activity;biotin carboxylase activity | GO:0030497;GO:0009372 | fatty acid elongation;quorum sensing | 6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.7320ORacetyl-CoA carboxylaseANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.7320 OR acetyl-CoA carboxylase AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.7760 | Tbg972.8.7760:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1953 | Tbg972.8.7760 | metallo-peptidase, Clan MA(E) Family M1, putative | metallo-peptidase, Clan MA(E) Family M1, putative | | | 8 | Tbg972_08:1,930,051..1,932,003(+) | Tbg972_08:1930051..1932003(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 55 | OG6_158281 | 0 | 650 | 1953 | 70915 | 7.28 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.7760ORmetallo-peptidase, Clan MA(E) Family M1, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.7760 OR metallo-peptidase, Clan MA(E) Family M1, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.8340 | Tbg972.8.8340:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 945 | Tbg972.8.8340 | monoglyceride lipase, putative | monoglyceride lipase, putative | | | 8 | Tbg972_08:2,111,318..2,112,262(+) | Tbg972_08:2111318..2112262(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 80 | OG6_100231 | 1 | 314 | 945 | 35221 | 7.23 | 0 | HMM: MGCFCCCCCCAVRDSH, NN: MGCFCCCCCCAVRDSH | NN Sum: 0, NN D: .16, HMM Prob: .55 | | | | | | | GO:0005737;GO:0005886 | cytoplasm;plasma membrane | GO:0016787 | hydrolase activity | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.8340ORmonoglyceride lipase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.8340 OR monoglyceride lipase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.8.8670 | Tbg972.8.8670:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2418 | Tbg972.8.8670 | cysteine peptidase, putative | cysteine peptidase, putative | | | 8 | Tbg972_08:2,198,549..2,200,966(+) | Tbg972_08:2198549..2200966(+) | Tbg972_08 | Trypanosoma brucei gambiense DAL972 | 56 | OG6_143858 | 1 | 805 | 2418 | 89754 | 4.26 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.8.8670ORcysteine peptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.8.8670 OR cysteine peptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.1720 | Tbg972.9.1720:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3156 | Tbg972.9.1720 | endo-beta-N-acetylglucosaminidase, putative | endo-beta-N-acetylglucosaminidase, putative | | | 9 | Tbg972_09:411,698..414,853(+) | Tbg972_09:411698..414853(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_104188 | 0 | 1051 | 3156 | 115908 | 5.74 | 0 | | | GO:0005737 | cytoplasm | GO:0033925 | mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity | | | GO:0005737 | cytoplasm | GO:0016798 | hydrolase activity, acting on glycosyl bonds | | | 3.2.1.96 (Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase) | 3.2.1.96 (Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.1720ORendo-beta-N-acetylglucosaminidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.1720 OR endo-beta-N-acetylglucosaminidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.2320 | Tbg972.9.2320:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1137 | Tbg972.9.2320 | DNA-damage inducible protein DDI1-like protein, putative | DNA-damage inducible protein DDI1-like protein, putative | | | 9 | Tbg972_09:525,506..526,642(+) | Tbg972_09:525506..526642(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_101685 | 0 | 378 | 1137 | 41043 | 4.34 | 0 | | | | | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | GO:0005654 | nucleoplasm | GO:0003674 | molecular_function | GO:0006289 | nucleotide-excision repair | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.2320ORDNA-damage inducible protein DDI1-like protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.2320 OR DNA-damage inducible protein DDI1-like protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.2390 | Tbg972.9.2390:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1434 | Tbg972.9.2390 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | | | 9 | Tbg972_09:538,670..540,103(+) | Tbg972_09:538670..540103(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_100777 | 0 | 477 | 1434 | 53709 | 6.41 | 0 | NN: MFRPSFCRCLPVLNCTLSAPQCAAAI, HMM: MFRPSFCRCLPVLNCTLSAPQCAAAI | NN Sum: 4, NN D: .57, HMM Prob: .99 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0020023;GO:0017087;GO:0005739 | kinetoplast;mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0030150 | protein import into mitochondrial matrix | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.2390ORmitochondrial-processing peptidase subunit beta, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.2390 OR mitochondrial-processing peptidase subunit beta, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.2640 | Tbg972.9.2640:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1098 | Tbg972.9.2640 | presenilin-like aspartic peptidase, putative | presenilin-like aspartic peptidase, putative | | | 9 | Tbg972_09:597,338..598,435(+) | Tbg972_09:597338..598435(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_101989 | 0 | 365 | 1098 | 40236 | 8.03 | 7 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | GO:0016485 | protein processing | GO:0005737 | cytoplasm | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.2640ORpresenilin-like aspartic peptidase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.2640 OR presenilin-like aspartic peptidase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.2940 | Tbg972.9.2940:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4029 | Tbg972.9.2940 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 9 | Tbg972_09:655,560..659,588(+) | Tbg972_09:655560..659588(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_145141 | 0 | 1342 | 4029 | 151149 | 5.41 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | GO:0004197;GO:0004221;GO:0004843 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.2940ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.2940 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.390 | Tbg972.9.390:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1806 | Tbg972.9.390 | btb/poz domain containing protein, putative | btb/poz domain containing protein, putative | | | 9 | Tbg972_09:73,513..75,318(-) | Tbg972_09:73513..75318(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_139357 | 0 | 601 | 1806 | 67680 | 6.78 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.390ORbtb/poz domain containing protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.390 OR btb/poz domain containing protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.4110 | Tbg972.9.4110:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2571 | Tbg972.9.4110 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 9 | Tbg972_09:930,493..933,063(-) | Tbg972_09:930493..933063(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 137 | OG6_127587 | 1 | 856 | 2571 | 95484 | 4.81 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.4110ORcysteine peptidase, Clan CA, family C2, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.4110 OR cysteine peptidase, Clan CA, family C2, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.4510 | Tbg972.9.4510:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 990 | Tbg972.9.4510 | serine peptidase, Clan S- , family S54, putative | serine peptidase, Clan S- , family S54, putative | | | 9 | Tbg972_09:1,017,772..1,018,761(-) | Tbg972_09:1017772..1018761(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 48 | OG6_147170 | 0 | 329 | 990 | 36752 | 8.46 | 4 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0031966 | mitochondrial membrane | | | GO:0030150 | protein import into mitochondrial matrix | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.4510ORserine peptidase, Clan S- , family S54, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.4510 OR serine peptidase, Clan S- , family S54, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.4950 | Tbg972.9.4950:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1284 | Tbg972.9.4950 | metallo- peptidase, Clan M- Family M48 | metallo- peptidase, Clan M- Family M48 | | | 9 | Tbg972_09:1,101,676..1,102,959(-) | Tbg972_09:1101676..1102959(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 47 | OG6_101632 | 0 | 427 | 1284 | 48812 | 8.80 | 5 | NN: MVAWGGMTFYGTALIGLNAL, HMM: MVAWGGMTFYGTALIGLNALAL | NN Sum: 2, NN D: .53, HMM Prob: .69 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0020015;GO:0005741;GO:0005739 | glycosome;mitochondrial outer membrane;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0071586;GO:0006508 | CAAX-box protein processing;proteolysis | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.4950ORmetallo- peptidase, Clan M- Family M48ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.4950 OR metallo- peptidase, Clan M- Family M48 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.5530 | Tbg972.9.5530:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 753 | Tbg972.9.5530 | proteasome alpha 1 subunit, putative | proteasome alpha 1 subunit, putative | | | 9 | Tbg972_09:1,214,647..1,215,399(-) | Tbg972_09:1214647..1215399(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 48 | OG6_102240 | 0 | 250 | 753 | 27543 | 6.66 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005839 | cytoplasm;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.5530ORproteasome alpha 1 subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.5530 OR proteasome alpha 1 subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.6490 | Tbg972.9.6490:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1113 | Tbg972.9.6490 | Serine peptidase, Clan SC, Family S09X | Serine peptidase, Clan SC, Family S09X | | | 9 | Tbg972_09:1,397,170..1,398,282(-) | Tbg972_09:1397170..1398282(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 48 | OG6_101827 | 0 | 370 | 1113 | 41332 | 7.80 | 1 | HMM: MSAERVAVTLLMWVLVALLVSTIFLA, NN: MSAERVAVTLLMWVLVALLVSTIFLAAVGY | NN Sum: 4, NN D: .75, HMM Prob: .65 | | | | | | | GO:0005783 | endoplasmic reticulum | GO:0003824 | catalytic activity | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.6490ORSerine peptidase, Clan SC, Family S09XANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.6490 OR Serine peptidase, Clan SC, Family S09X AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.6750 | Tbg972.9.6750:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 768 | Tbg972.9.6750 | proteasome beta 2 subunit, putative | proteasome beta 2 subunit, putative | | | 9 | Tbg972_09:1,450,885..1,451,652(+) | Tbg972_09:1450885..1451652(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 47 | OG6_101382 | 0 | 255 | 768 | 27388 | 8.32 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0019774 | proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.6750ORproteasome beta 2 subunit, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.6750 OR proteasome beta 2 subunit, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.7210 | Tbg972.9.7210:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2307 | Tbg972.9.7210 | DNA-repair protein, putative | DNA-repair protein, putative | | | 9 | Tbg972_09:1,533,118..1,535,424(+) | Tbg972_09:1533118..1535424(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 53 | OG6_144738 | 0 | 768 | 2307 | 85747 | 10.01 | 0 | | | | | GO:0003677 | DNA binding | | | GO:0005737;GO:0031981;GO:0005634 | cytoplasm;nuclear lumen;nucleus | GO:0003684 | damaged DNA binding | GO:0006289 | nucleotide-excision repair | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.7210ORDNA-repair protein, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.7210 OR DNA-repair protein, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.7990 | Tbg972.9.7990:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1269 | Tbg972.9.7990 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | | 9 | Tbg972_09:1,708,855..1,710,123(+) | Tbg972_09:1708855..1710123(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 50 | OG6_138036 | 0 | 422 | 1269 | 46907 | 8.87 | 5 | NN: MSVVEMEKDSQPEQPMRSKNFLHRVGTTILFVGTSFAL, HMM: MSVVEMEKDSQPEQPMRSKNFLHRVGTTILFVGTSFAL | NN Sum: 3, NN D: .39, HMM Prob: .01 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.7990ORAlpha/beta hydrolase family, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.7990 OR Alpha/beta hydrolase family, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.8400 | Tbg972.9.8400:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1338 | Tbg972.9.8400 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 9 | Tbg972_09:1,786,455..1,787,792(-) | Tbg972_09:1786455..1787792(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 49 | OG6_136424 | 0 | 445 | 1338 | 50429 | 7.01 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | GO:0004197;GO:0004221;GO:0004843 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.8400ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.8400 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.8450 | Tbg972.9.8450:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1470 | Tbg972.9.8450 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | | 9 | Tbg972_09:1,799,797..1,801,266(-) | Tbg972_09:1799797..1801266(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 54 | OG6_102295 | 0 | 489 | 1470 | 54349 | 5.76 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | GO:0005737 | cytoplasm | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.8450ORmetallo-peptidase, Clan MG, Family M24ANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.8450 OR metallo-peptidase, Clan MG, Family M24 AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.890 | Tbg972.9.890:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2235 | Tbg972.9.890 | cysteine peptidase, Clan CA, family C48, putative | cysteine peptidase, Clan CA, family C48, putative | | | 9 | Tbg972_09:218,159..220,393(-) | Tbg972_09:218159..220393(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 51 | OG6_101235 | 0 | 744 | 2235 | 82802 | 8.30 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.890ORcysteine peptidase, Clan CA, family C48, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.890 OR cysteine peptidase, Clan CA, family C48, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.8930 | Tbg972.9.8930:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1479 | Tbg972.9.8930 | metacaspase 5, putative | metacaspase 5, putative | | | 9 | Tbg972_09:1,886,399..1,887,877(-) | Tbg972_09:1886399..1887877(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 154 | OG6_101407 | 4 | 492 | 1479 | 54466 | 8.67 | 0 | NN: MDAALALLFGQVATAV, HMM: MDAALALLFGQVATAV | NN Sum: 3, NN D: .59, HMM Prob: .99 | | | | | | | GO:0051286;GO:0097014;GO:0005737;GO:0031981 | cell tip;ciliary plasm;cytoplasm;nuclear lumen | GO:0030693 | obsolete caspase activity | GO:0006508 | proteolysis | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.8930ORmetacaspase 5, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.8930 OR metacaspase 5, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.9090 | Tbg972.9.9090:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3486 | Tbg972.9.9090 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 9 | Tbg972_09:1,919,155..1,922,640(-) | Tbg972_09:1919155..1922640(-) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 52 | OG6_101317 | 0 | 1161 | 3486 | 132467 | 6.99 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | GO:0004197;GO:0004221;GO:0004843 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.9090ORubiquitin carboxyl-terminal hydrolase, putativeANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.9090 OR ubiquitin carboxyl-terminal hydrolase, putative AND Trypanosoma brucei gambiense DAL972 |
|
Tbg972.9.9450 | Tbg972.9.9450:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1716 | Tbg972.9.9450 | hypothetical protein, conserved | hypothetical protein, conserved | | | 9 | Tbg972_09:2,017,485..2,019,200(+) | Tbg972_09:2017485..2019200(+) | Tbg972_09 | Trypanosoma brucei gambiense DAL972 | 54 | OG6_124708 | 0 | 571 | 1716 | 65905 | 6.51 | 0 | HMM: MLLTYFLFCLFVCSCQ, NN: MLLTYFLFCLFVCSCQPL | NN Sum: 4, NN D: .74, HMM Prob: 1 | | | | | | | GO:0030964;GO:0005739 | NADH dehydrogenase complex;mitochondrion | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Tbg972.9.9450ORhypothetical protein, conservedANDTrypanosoma brucei gambiense DAL972 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Tbg972.9.9450 OR hypothetical protein, conserved AND Trypanosoma brucei gambiense DAL972 |